Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

parB

Victor ID 612
Gene Name parB
Sequence Strain (Species/Organism) Francisella tularensis
NCBI Gene ID 3191409
NCBI Protein GI 56708009
Locus Tag FTT0908
Protein Accession YP_169905.1
Other Database IDs UniProtKB-ID: Q5NGD7_FRATT
UniRef100: UniRef100_A7NAC4
UniRef90: UniRef90_A7NAC4
UniRef50: UniRef50_B0TZZ3
UniParc: UPI000049C3E6
EMBL: AJ749949
EMBL-CDS: CAG45541.1
RefSeq_NT: NC_006570.2
GenomeReviews: AJ749949_GR
HOGENOM: HBG482706
OMA: VINIKNI
ProtClustDB: CLSK986333
Taxonomy ID 177416
Gene Starting Position 916840
Gene Ending Position 917754
Gene Strand (Orientation) +
Protein Name chromosome partition protein B
DNA Sequence
>gi|56707187:916840-917754 Francisella tularensis subsp. tularensis Schu 4, complete genome
AATGGCTAAAAAAGTTTCCTTAATGAACCGTAAAATCAATCATAAGATTCATGACACTGTTGCTCAAGAG
AAAAAAGATATCCTTAGAGCTATGCAGCTACAAGAACTAAACGAACAGGCAAGCAAGGTTGGTCAGCTTT
TTGAATTACCTTTGACTATTATAAAACCAGATGCCAATCAGCCGCGTAAGACATTTAAAAATATCGACTC
TCTTGCTGATAGCATCAAAGAAAATGGCGTAATTCAGCCGATTATCGTTACTGCTAAAAAAGCTAATGGT
ATTCATTATATAATAGCTGGCGAACGAAGATATTTAGCAAGCAAACAGGCTGGTCTAACAACAATACCTT
GTATAGTTCGACAAGAGGAGTCTGATGCAAATATTGTGCTATTACAGCTTTTGGAAAATGATCAAAGAGA
AAATGTCTCACCATTTGAAGAGGCTGATGCCTTGAGAGATTTGATAGAGAATAAGAATGTCAAAAAATCT
GATATCGCTAAGATTTTGGGCAGAGATAATAGTTGGATATCTATGCGTCTAAAGATAGCTGATGCTAATG
CGGATATTCGTGAGCTGTCAAATAGAGGTATTATTGATGATGTTAGAACTTTATATGAGCTTAAGAAGTT
TGCTGAAGAAATACCTCAAGGAGCTCAAGAGTTTGTCAAAAAAGCTTTAGAAAATAAAATTTCTGGTTCA
TATCGTAGCGCAATTACTCGCTATCGAGATAACTGGAAGCGTAAAGCTGAAATTTTAGATAGTACAAAAA
TTGATGTGATAACTATCAAAGATATCGCTAAAGATGGTAACCTTTTAAAAATAAAAGGTTCGCGTTGCGG
AACAAAAAATTATACATATACTTTTGAAATAACACCGGAGTTTAAGAAAATACTCTTTGATGCGCTAATA
AATTA
Protein Sequence
>gi|56708009|ref|YP_169905.1| chromosome partition protein B [Francisella tularensis subsp. tularensis SCHU S4] MAKKVSLMNRKINHKIHDTVAQEKKDILRAMQLQELNEQASKVGQLFELPLTIIKPDANQPRKTFKNIDSLADSIKENGVIQPIIVTAKKANGIHYIIAGERRYLASKQAGLTTIPCIVRQEESDANIVLLQLLENDQRENVSPFEEADALRDLIENKNVKKSDIAKILGRDNSWISMRLKIADANADIRELSNRGIIDDVRTLYELKKFAEEIPQGAQEFVKKALENKISGSYRSAITRYRDNWKRKAEILDSTKIDVITIKDIAKDGNLLKIKGSRCGTKNYTYTFEITPEFKKILFDALIN
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: a parB mutant was attenuated for infection in a mouse lung (Su et al., 2007)
COG COG1475K, under K: Transcription
References
Su et al., 2007: Su J, Yang J, Zhao D, Kawula TH, Banas JA, Zhang JR. Genome-wide identification of Francisella tularensis virulence determinants. Infection and immunity. 2007; 75(6); 3089-3101. [PubMed: 17420240].