Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pyrD

Victor ID 644
Gene Name pyrD
Sequence Strain (Species/Organism) Francisella tularensis
NCBI Gene ID 3191654
NCBI Protein GI 56708660
Locus Tag FTT1647c
Protein Accession YP_170556.1
Other Database IDs UniProtKB-ID: Q5NEI6_FRATT
UniRef100: UniRef100_A7N979
UniRef90: UniRef90_A7N979
UniRef50: UniRef50_A7N979
UniParc: UPI000049C5C0
EMBL: AJ749949
EMBL-CDS: CAG46280.1
RefSeq_NT: NC_006570.2
GenomeReviews: AJ749949_GR
HOGENOM: HBG482833
OMA: MSAKMQN
ProtClustDB: CLSK935123
Taxonomy ID 177416
Gene Starting Position 1712492
Gene Ending Position 1713238
Gene Strand (Orientation) -
Protein Name diyroorotate dehydrogenase
DNA Sequence
>gi|56707187:1712492-1713238 Francisella tularensis subsp. tularensis Schu 4, complete genome
TTTAAAAATCATCTAGCCAAAATTTAACTATCTCTTTAACTAACTTTTTACCTCTAATAGGATTAAACAT
TATTGAACTTAGTGATAAATGATCCGCTCCTGCTTCGATATATTTCTTGGCATCATCTAGAGTGTAAATA
CCGCCTCCACCAATTATTGTGATACTATCACCAAACTCTTGTCTAGCTTTTTTGATAGCCGGCAGACTAT
ACTTATGTAATGGATAACCTGAAATGCCACCCTTAGCTGTTGGAATAGTATTACATAGATGAAAAGTTGT
AATCCCTACTGCAAGATATTCTCTAATCTTAGCATTATGATCAACAGTTGGCGGCATTTTAATACTAATA
TTTCTATCCTCAAATAAAGGTGCTAATTCAGCTGGAAAATCAACAATGCTTGCATTAGGACAACCAATAT
TAATCTCAATATTTCTATGTTGAGCAAACTTCGGTAACTTTAAAGTTTCTGCAAAACTATGCCAGTCAGA
CATATCTAACGCCGCTAAAGATATAATATCTTGTGCTCTTTTGGGCGGATTTGTATTTGCCAAACCTGGA
TTACGTAAACCAATCTTGTTACGCCAAGCATTTTTATCTATTTTACGGATAGTTTTGATCGCTTGTTTGA
TAAGTCCCCAGCGTCTATTCACAGTAAAAGAACCATAAACATTCGAAGTTTCTTTAAATTTAAGATATTT
ACCAAACGGTGGCGAGATTATTATTCTTTTAAGATCTTGATTTTGCA
Protein Sequence
>gi|56708660|ref|YP_170556.1| diyroorotate dehydrogenase [Francisella tularensis subsp. tularensis SCHU S4] MQNQDLKRIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIGLRNPGLANTNPPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPPTVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFWLDDF
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: pyrD mutant is attenuated in mouse spleen (Weiss et al., 2007).
COG COG0167F, under F: Nucleotide transport and metabolism
References
Weiss et al., 2007: Weiss DS, Brotcke A, Henry T, Margolis JJ, Chan K, Monack DM. In vivo negative selection screen identifies genes required for Francisella virulence. Proceedings of the National Academy of Sciences of the United States of America. 2007; 104(14); 6037-6042. [PubMed: 17389372].