Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rpmJ from Francisella tularensis subsp. tularensis SCHU S4

Victor ID 692
Gene Name rpmJ from Francisella tularensis subsp. tularensis SCHU S4
Sequence Strain (Species/Organism) Francisella tularensis subsp. tularensis SCHU S4
NCBI Gene ID 3191985
NCBI Protein GI 56707499
Locus Tag FTT0346
Protein Accession YP_169395.1
Other Database IDs UniProtKB-ID: RL36_FRATT
UniRef100: UniRef100_Q14J99
UniRef90: UniRef90_Q14J99
UniRef50: UniRef50_Q14J99
UniParc: UPI000049C273
EMBL: AJ749949
EMBL-CDS: CAG44979.1
RefSeq_NT: NC_006570.2
HSSP: P80256
GenomeReviews: AJ749949_GR
HOGENOM: HBG088952
ProtClustDB: PRK00465
Taxonomy ID 177416
Gene Starting Position 347883
Gene Ending Position 347996
Gene Strand (Orientation) +
Protein Name 50S ribosomal protein L36
DNA Sequence
>gi|56707187:347883-347996 Francisella tularensis subsp. tularensis Schu 4, complete genome
AATGAAAGTTAGAGCTTCAGTTAAAAAAATGTGTAGAAACTGTAAAGTTATCAAGCGCAATAGAGTAGTT
CGTGTGATATGTACAGATCCTAGACATAAGCAAAGACAAGGATA
Protein Sequence
>gi|56707499|ref|YP_169395.1| 50S ribosomal protein L36 [Francisella tularensis subsp. tularensis SCHU S4] MKVRASVKKMCRNCKVIKRNRVVRVICTDPRHKQRQG
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: a rpmJ mutant was attenuated for infection in a mouse lung (Su et al., 2007)
References
Su et al., 2007: Su J, Yang J, Zhao D, Kawula TH, Banas JA, Zhang JR. Genome-wide identification of Francisella tularensis virulence determinants. Infection and immunity. 2007; 75(6); 3089-3101. [PubMed: 17420240].